General Information

  • ID:  hor006877
  • Uniprot ID:  P01579
  • Protein name:  Interferon gamma
  • Gene name:  IL5
  • Organism:  Homo sapiens
  • Family:  Type II (or gamma) interferon family
  • Source:  Human
  • Expression:  Released primarily from activated T lymphocytes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005133 type II interferon receptor binding; GO:0005125 cytokine activity
  • GO CC:  GO:0060559 positive regulation of calcidiol 1-monooxygenase activity; GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process; GO:0010508 positive regulation of autophagy; GO:1902004 positive regulation of amyloid-beta formation; GO:0150076 neuroinflammatory response; GO:0000122 negative regulation of transcription by RNA polymerase II; GO:1902948 negative regulation of tau-protein kinase activity; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0032700 negative regulation of interleukin-17 production; GO:0010629 negative regulation of gene expression; GO:0008284 positive regulation of cell population proliferation; GO:1901857 positive regulation of cellular respiration; GO:0032722 positive regulation of chemokine production; GO:1904798 positive regulation of core promoter binding; GO:0001819 positive regulation of cytokine production; GO:0010634 positive regulation of epithelial cell migration; GO:1903543 positive regulation of exosomal secr

Sequence Information

  • Sequence:  DPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
  • Length:  137
  • Propeptide:  MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
  • Signal peptide:  MKYTSYILAFQLCIVLGSLGCYC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA